PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g14467.1.p
Common NameBRADI_1g14467, LOC100826107
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 303aa    MW: 33688.3 Da    PI: 7.2899
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g14467.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.32.1e-5551301128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeel+++yL +kv++  +++ ++i++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkdke++
  Bradi1g14467.1.p   5 LPPGFRFHPTDEELITYYLSRKVSDFAFST-RAIADVDLNKCEPWDLPSKASMGEKEWYFFSMRDRKYPTGIRTNRATESGYWKTTGKDKEIF 96 
                       79*************************999.89***************999999*************************************** PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +  g+l g+kktLvfy grapkgekt+Wvmheyr+
  Bradi1g14467.1.p  97 H-CGRLAGMKKTLVFYGGRAPKGEKTSWVMHEYRI 130
                       *.99*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-633151IPR003441NAC domain
PROSITE profilePS5100559.3155151IPR003441NAC domain
PfamPF023656.1E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MEEGLPPGFR FHPTDEELIT YYLSRKVSDF AFSTRAIADV DLNKCEPWDL PSKASMGEKE  60
WYFFSMRDRK YPTGIRTNRA TESGYWKTTG KDKEIFHCGR LAGMKKTLVF YGGRAPKGEK  120
TSWVMHEYRI QNKFPYKPNK EEWVVCRVFK KSQIVKMRHP QDSPEMDSPC HDTNVSLGEL  180
GELDVSSMLG SFAPGAAAAH ASGADNFGHR VDMGAYMSWL AAAAANQGAA AMLPWAPGLL  240
GTVFAANPAM QKALPFAGCS QPRDVVGAGD ALFGTVMPKV DMECEQHHHS QLEINESTWR  300
TF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-56515117165NAC domain-containing protein 19
4dul_A1e-56515117165NAC domain-containing protein 19
1ut7_B1e-56515117165NO APICAL MERISTEM PROTEIN
1ut7_A1e-56515117165NO APICAL MERISTEM PROTEIN
1ut4_B1e-56515117165NO APICAL MERISTEM PROTEIN
1ut4_A1e-56515117165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562269.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotO040177e-78NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLI1GQ880.0I1GQ88_BRADI; Uncharacterized protein
STRINGBRADI1G14467.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.12e-92NAC domain containing protein 58